PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678466846
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family FAR1
Protein Properties Length: 821aa    MW: 94426.2 Da    PI: 7.1905
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678466846genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR188.87.8e-2864151191
       FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                +fY+eYAk++GF++++++s++sk+++e+++++f Cs++g + e++++   ++r++++++t+Cka+++vk+++dg w+++++ +eHnHel p
  678466846  64 SFYQEYAKSMGFTTSIKNSRRSKKTKEFIDAKFACSRYGMTPESETS---SSRRSSVKKTDCKASMHVKRKRDGGWYIHEFIKEHNHELLP 151
                5***************************************9998877...889999********************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.8E-2564151IPR004330FAR1 DNA binding domain
PfamPF105518.9E-20272364IPR018289MULE transposase domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 821 aa     Download sequence    Send to blast
MVGCEGNAKC GRGDALNVID AVDSVQSRDD PLNTCPKTDV SGIEGSRFEP DEGIDFESHE  60
AAYSFYQEYA KSMGFTTSIK NSRRSKKTKE FIDAKFACSR YGMTPESETS SSRRSSVKKT  120
DCKASMHVKR KRDGGWYIHE FIKEHNHELL PALAYHFHIH RNVRLAEKNN IDILHAVSER  180
TRKMYVEMCR QYGGIHEPSF SKNEVDHQAD GARCMALDEG DARFMMDTFM QLQKESPYFS  240
YAVELNREQR VRNLFWIDSK SRKDYIFFSD AVFLDTTFVK SSDKVPIALF LGVNHHFQPM  300
LLGCALLADE SKSTFVWLLK TWLRAVGGKA PNLILSCQDT QLKLAIEEIF PCSRHCFPLW  360
HVMEKIPVTL GHVLRLHVNF IKKFNKCISR SLTDEEFDMR WWKMVTRFEL QENEWVHSLY  420
VERKKWAPIF MRDAFLAGLS PRQRSDSVNS FFDKYIHKKM NVNEFMRQYI VILQNRSEEE  480
DLADFDMLHR QPALKSPSPW EKQMSTIYTH SIFRKFQVEV LGVVGCHPKK EREDGVNVTF  540
KVDDCEKGEN FVVMWNEEMS ELCGLSRIPS QYILKRWTKD AKVRQGDLEE TDSAHTRVQR  600
YNDLCKIAIA LGEEGSSCEE NYNIACRALV QALKNCVNVN NRTAVDSSSN SVGLRFSEQE  660
TLLLHGNKSS KKKNSGKKRK QEPEPIVNET EDNIEPLETL SSQEMTLNGY YGSQQNVHGM  720
LNLMEPPQDG YYVSQPTLPG MVRRSACGVA CALMFHVTCF IKDECHYSQL NSIPSGHDSF  780
YGAQQNLPAL GHLDFRQATF PYIMQGDHSV RQPELQEGAR N
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00434DAPTransfer from AT4G15090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011085457.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1
RefseqXP_011085456.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1
SwissprotQ9SWG30.0FAR1_ARATH; Protein FAR-RED IMPAIRED RESPONSE 1
TrEMBLA0A022RW200.0A0A022RW20_ERYGU; Uncharacterized protein
STRINGSolyc08g060840.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49621103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G15090.10.0FAR1 family protein